PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10012513m
Common NameEUTSA_v10012513mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARF
Protein Properties Length: 1089aa    MW: 120646 Da    PI: 6.879
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10012513mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.55.1e-2370171199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++p++ ae++      +++++++ +l+ +d + ++W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F +  + 
  Thhalv10012513m  70 FCKTLTASDTSTHGGFSVPRRAAEKIfpaldfSMQPPCQ-ELVAKDIHDNTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFIR--DG 160
                      99*****************************98888885.9************************************************5..46 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      +++l+++++r+
  Thhalv10012513m 161 KAQLLLGIRRA 171
                      78889999997 PP

2Auxin_resp118.84.5e-39196278183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      aaha +++s+F+++YnPra++seFvv+++k+ ka++ +vs+GmRf+m fete++  rr++Gtv+g+sdldpvrW+nS+Wr+L+
  Thhalv10012513m 196 AAHANANNSPFTIFYNPRAAPSEFVVPLAKYTKAMYAQVSLGMRFRMIFETEECGVRRYMGTVTGISDLDPVRWKNSQWRNLQ 278
                      799******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-4260199IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.3E-4164185IPR015300DNA-binding pseudobarrel domain
CDDcd100179.62E-2069170No hitNo description
SMARTSM010199.7E-2370172IPR003340B3 DNA binding domain
PROSITE profilePS5086312.12570172IPR003340B3 DNA binding domain
PfamPF023622.8E-2170171IPR003340B3 DNA binding domain
PfamPF065073.5E-34196278IPR010525Auxin response factor
PfamPF023096.2E-109581047IPR033389AUX/IAA domain
PROSITE profilePS5174526.9569611054IPR000270PB1 domain
SuperFamilySSF542779.32E-99741039No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009638Biological Processphototropism
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010311Biological Processlateral root formation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 1089 aa     Download sequence    Send to blast
MQKQTDFIPS YPNLPSKLIC MLHNVTLNAD PETDEVYAQM TLQPVNKYDR DALLASDMGL  60
KLNRQPNEFF CKTLTASDTS THGGFSVPRR AAEKIFPALD FSMQPPCQEL VAKDIHDNTW  120
TFRHIYRGQP KRHLLTTGWS VFVSTKRLFA GDSVLFIRDG KAQLLLGIRR ANRQQPALSS  180
SVISSDSMHI GVLAAAAHAN ANNSPFTIFY NPRAAPSEFV VPLAKYTKAM YAQVSLGMRF  240
RMIFETEECG VRRYMGTVTG ISDLDPVRWK NSQWRNLQIG WDESAAGDRP SRVSVWDIEP  300
VLTPFYICPP PFFRPRFAGQ PGMPDDETDM ESALKRAMPW LDNSLEMKDP SSTIFPGLSL  360
VQWMNMQQQN GQLPSAAAQS GFFPSQTAAL HNSLGGTDDP SKLLSFQTPP GGISSSNLQF  420
NKPNPQAPMS QLPQPSTTLS QQQQLQQLLH ASLNHQQQQS LSQQQQQQQS LQQQHQQPLQ  480
QQSQQLQQSQ QLRTQPSQSH SHPQPQPQPQ HLQPHKLQQF QLPQNQLYNG QQAAQQFKEQ  540
QASMHHLLPQ VVSESMASSV IAPSSSSHNQ SFQQQQQSTQ LHHTHRHLGA STSQSSVIET  600
SKSSSNLMSI PPQDTQFPRQ VEQQQPPGLV KGHNQQTLLQ QKTQQAQAHA QVQQLFQQNL  660
LEQPHLQFQL LQRLQQQQQQ QQQQQHQQFL SPGSSSMQSQ LLHQQLPQLP SLSQGQQFPS  720
SCINNGLSTL QPPQMVVSRP QDKQNPPVGG GVKAYSGITD GGDAPSSSTS PSTNNCQISS  780
SSFLNRSQSG PAILIPDTPV DMSGSLVQEL YNKSDMRQKQ ELVGQQKAKA SLTDHQLEAS  840
ASGTSYGLDG GDNNRQQNFL APTFGLDGDS RNSLLGGATV DNGFVPDTLL SRGYDSQKDL  900
QNMLSNYGGV TNDIGTEMST SAVRTQSFGI PNVPAFSNDV AVNDAAVLGG GLWPTQTQRM  960
RTYTKVQKRG SVGRSIDVNR YRGYDELRHD LARMFGIEGQ LEDPQTSDWK LVYVDHENDI  1020
LLVGDDPWEE FVNCVQSIKI LSSAEVQQMS LDGNFTGVPV TNQACSGGDS GNAWRGHYDD  1080
NSATSFNR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-145829996388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN9794700.0JN979470.1 Brassica rapa subsp. pekinensis auxin response factor 7-2 (ARF7-2) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006400643.10.0hypothetical protein EUTSA_v10012513mg
TrEMBLV4N8R70.0V4N8R7_EUTSA; Auxin response factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20730.20.0ARF family protein